xing.com xing.com Xing – ideen für eine neue arbeitsweltjobsberufenetzwerk ▷ xing ist der persönliche begleiter für dein berufsleben. knüpfe berufliche kontakte und entdecke spannende jobs, events, news und gruppen.

tagesspiegel.de tagesspiegel.de Aktuelle news: nachrichten aus berlin und der welt – tagesspiegel facebook ▷ aktuelle news aus berlin – nachrichten aus deutschland und der welt – kommentare, hintergrã¼nde und interviews aus politik, wirtschaft und berlin.

hereon.de hereon.de Helmholtz zentrum hereon spitzenforschung für eine welt im wandelklimaforschungküstenforschungneue technologienmaterialforschung ▷ helmholtz-zentrum hereon, großforschungszentrum der helmholtz-gemeinschaft mit hauptsitz in geesthacht

librechurch.org librechurch.org Librechurch freie software für eine freie kirche ▷ wir entwickeln nachhaltige it-lösungen für die digitale kirche von morgen. zuverlässige online-tools für zusammenarbeit und kommunikation. dazu vernetzen wir die arbeit der weltweiten open-source-community mit der kirche.

digitalezivilgesellschaft.org digitalezivilgesellschaft.org Vier forderungen für eine digital souveräne gesellschaft ▷ empfehlungen der zivilgesellschaft für eine unabhängige digitale infrastruktur und freien zugang zu wissen einsetzen.

barmherzigkeit.at barmherzigkeit.at Aktuell barmherzigkeit verein zur hilfe bedürftiger menschen in aller welt % % ▷ südsudan: bitte sichern sie trinkwasser für die ärmsten! wasser – und sauberes ganz besonders – bleibt hier eine kostbarkeit.

wecanhelp.de wecanhelp.de Wecanhelp.de mach aus deinem einkauf eine gute tatwecanhelpspendenkaufen und helfeneinkaufenshoppenhelfencharitykaufwebsucheshopsuchepreisvergleich ▷ auf wecanhelp.de kannst du 12.781 einrichtungen und projektgruppen mit deinen einkäufen bei shops ohne mehrkosten unterstützen. insgesamt wurden schon über 10,60 mio. € gesammelt.

bildungsspender.de bildungsspender.de Bildungsspender.de mach aus deinem einkauf eine gute tatbildungsspenderspendenkaufen und helfeneinkaufenshoppenhelfencharitykaufwebsucheshopsuchepreisvergleich ▷ auf bildungsspender.de kannst du 12.781 einrichtungen und projektgruppen mit deinen einkäufen bei shops ohne mehrkosten unterstützen. insgesamt wurden schon über 10,60 mio. € gesammelt.

n24.de n24.de Welt aktuelle nachrichten, news, hintergründe & videoswelt.dewww.welt.dewelt onlinenachrichtennewsberichteinformationenkolumnenlivetickernewstickernachrichten-appnews-apparchivzeitungs-archivnachrichten-archivjahres-archivvolltext-suchenachrichten-sucheartikel-suchemedienpolitikbörsesportwirtschaftfinanzenlifestylefernsehentvtv-programmfernsehprogrammreiseurlaubzippertkulturliteratursatirewelt am sonntagwamswelt kompaktn24 ▷ nachrichten, kommentare, liveticker, videos und streams sowie news aus politik, wirtschaft, finanzen, wetter, sport, fußball, kultur, reise und internet ...

jetztrettenwirdiewelt.de jetztrettenwirdiewelt.de Homepage und jetzt retten wir die welt! ▷ und jetzt retten wir die welt! ist die initiative für alle, die dinge hinterfragen und anleitungen für ein bewussteres, öko-sozialeres leben suchen.

fuereinebesserewelt.info fuereinebesserewelt.info Für eine bessere welt menschen, ideen, visionen, projekte und aktionen für eine bessere welt. ▷ menschen, ideen, visionen, projekte und aktionen für eine bessere welt.

merkur.de merkur.de Aktuelle nachrichten aus münchen, bayern & der welt merkur.de ▷ der münchner merkur & seine heimatzeitungen online. nachrichten aus bayern, deutschland & der welt, dazu sport, politik, wirtschaft und kultur.

mopo.de mopo.de Mopo.de aktuelle nachrichten aus hamburg, der welt, zum hsv und der welt der promis. ▷ hamburger morgenpost - aktuelle nachrichten aus hamburg, der welt, zum hsv und der welt der promis.

morgenpost.de morgenpost.de Aktuelle nachrichten aus berlin und der welt berliner morgenpost berlinsportherthapolitiktegelsenatberwirtschaftkulturmuseen ▷ aktuelle nachrichten und hintergründe aus politik, wirtschaft und sport aus berlin, deutschland und der welt.

shz.de shz.de Nachrichten aus schleswig holstein und der welt shz.de shz.de shz.de shz.desh:zschleswig-holsteinischer zeitungsverlagnachrichtennewsreportagenmeldungenvideosbilderschleswig-holsteinhamburg ▷ newsportal für schleswig-holstein mit lokalen und überregionalen nachrichten, reportagen, videos und bildern aus schleswig-holstein und der welt.

admeira.ch admeira.ch Admeira eine neue perspektive für die schweizadmeiramedienmarkewerbemöglichkeitenportfoliomultimedialvermarktungsfirma ▷ admeira ist ein führendes vermarktungsunternehmen für tv-werbung in der schweiz. als exklusive partnerin der srg ssr und weiterer privaten medienhäuser.

nicht-spurlos.de nicht-spurlos.de Nicht spurlos ein otto normal verbraucher blickt auf die welt ▷ ein otto-normal-verbraucher blickt auf die welt.

spinlab.co spinlab.co 100% free startup accelerator program in leipzig spinlab ▷ we support early phase startups who are developing concepts in the areas of smart city, energy, and ehealth in our free startup accelerator program.

bme.de bme.de Bme – eine starke gemeinschaft für einkauf und logistik bme – eine starke gemeinschaft für einkauf und logistik ▷ der bme – seit 1954 eine starke gemeinschaft für einkauf und logistik! ihr partner für den erfahrungsaustausch und die fachliche aus- und weiterbildung.

mapsme.de mapsme.de Maps.me (mapswithme), detaillierte offline karten aus aller welt für iphone, ipad, android ▷ maps.me (mapswithme) bietet offline-karten aus aller welt. karten der vereinigten staaten von amerika. new york, san francisco, washington. frankreich: paris. italien: rom, venedig, florenz, rimini. spanien: barcelona, madrid. japan,

m-r-n.com m-r-n.com Metropolregion rhein neckar – eine allianz starker partner ▷ „gemeinsam sind wir stärker“ ist das credo und erfolgsrezept der zusammenarbeit in der rhein-neckar-region.

reiseblog.saarland reiseblog.saarland Saarland reiseblog die welt steckt voller geschichten, auch das saarland!saarlandsaarlandtourismuswandernradfahrenkulturwellnesskulinarischsaarsaarschleifesaarbrückensaarlouismerzigottweilerhomburgst. wendelurlaubtourismusreisenferienangebotepauschalangeboteveranstaltungreiseblog ▷ gute geschichten, kloores, regionale tipps und exklusive einblicke in die saarländische seele. wer da war, kommt wieder!

rp-gemeinsamstark.de rp-gemeinsamstark.de #rpgemeinsamstark ♥ eine initiative der rheinischen post ▷ melden sie hier ihre hilfsangebote - die corona-krise braucht unsere mitmenschlichkeit.

winfuture.de winfuture.de Winfuture.de die ganze welt der it ▷ aktuelle nachrichten aus den bereichen software, hardware, spiele, internet und wirtschaft. neues über windows, office und weitere microsoft produkte.

senat-magazin.de senat-magazin.de Senate online – magazin für eine weltweite ökosoziale marktwirtschaft ▷ senate online - magazin für eine weltweite ökosoziale marktwirtschaft

geoformer.ch geoformer.ch Die natur ist unsere welt geoformer igp aggeoformer igp agnaturgefahreningenieurbürogeologiebürowallisoberwallis ▷ die geoformer igp ag vereint ein multidisziplinäres team von umwelt-, kultur-, forst- und bauingenieuren sowie geologen, geografen und umweltnaturwissenschaftlern.

kattascha.de kattascha.de Kattascha.de politik in der vernetzten welt facebook google+ instagram twitter ▷ blog zum thema politik, digitalisierung und populismus.

irights.info irights.info Irights.info urheberrecht und kreatives schaffen in der digitalen welt ▷ urheberrecht und kreatives schaffen in der digitalen welt

brot-fuer-die-welt.de brot-fuer-die-welt.de Brot für die welt   brot für die welt ▷ brot für die welt: seit mehr als 60 jahren gegen hunger und armut – mit projekten in mehr als 90 ländern. ihre spende hilft!

chip-kiosk.de chip-kiosk.de Chip kiosk der chip aboshop rund um die pc welt, inkl. photo magazin und software chip abosonderhefteaboservice ▷ ✓ chip abos direkt vom verlag im chip-kiosk rund um die pc welt: chip plus, chip magazin, chip foto-video das photo magazin, n-photo, magpi und chip wissen.

welt-photo.de welt-photo.de Welt photo at ullsteinbild.depictures for articlespictures for websitespictures for websitescontent for legal purchasecontent for legal usethe world of berlinphotos from berlinportraits welt.de ▷ acquire welt photos for reuse in your print and digital productions. use the best photos of welt photographers.

abendzeitung-muenchen.de abendzeitung-muenchen.de News aus münchen, sport, promis, bayern und der welt abendzeitung münchen ▷ nachrichten aus münchen und der welt. alles rund um den fc bayern und zum tsv 1860. promis, politik, polizei und panorama. die az informiert und unterhält sie!

weltladen-bonn.org weltladen-bonn.org Weltladen bonn e.v. start ▷ weltladen bonn e.v., ihr spezialist für fairen handel in der bonner altstadt. kommen sie doch vorbei in der maxstraße 36!

seitenmuehle.de seitenmuehle.de Webdesign leipzig seitenmühle internetagenturwebdesign leipziginternetagentur leipzigwebagentur leipzigseo leipzigwebagenturwordpress leipzigtypo3 leipzigwebdesign sachsenwebdesign agentur leipzigwebdesign agenturtypo3 agentur leipzigwordpress agentur leipzig ▷ webdesign aus leipzig - seitenmühle ist eine auf webdesign spezialisierte internetagentur aus leipzig. wir entwickeln webseiten für unternehmen.

coinless.ch coinless.ch Startseite coinless entdecke die welt ohne münzen ▷ das coinless slim ist ausgestattet mit einem ausziehbaren mechanismus. das wallet präsentiert sich in einem eleganten “business-look”!

localsearch.ch localsearch.ch Localsearch erfolg für kmu in der digitalen welt ▷ localsearch (swisscom directories ag) ist der führende marketing- und werbepartner für schweizer kmu und betreibt die plattformen local.ch und search.ch.

wolters-rundreisen.de wolters-rundreisen.de Wolters rundreisen erleben. die welt entdecken.rundreisenautoreisenbusreisenschiffsreisengöta kanalhurtigrutenreisenurlaubtui woltersnordeuropasüdeuropa ▷ mit dem rundreisen-spezialisten tui rundreisen nach europa – hier finden sie die passenden reiseangebote für ihren urlaub. buchen sie jetzt.

welthungerhilfe.de welthungerhilfe.de Für eine welt ohne hunger und armut welthungerhilfe ▷ unsere mission: eine welt ohne hunger und nachhaltige ernährungssicherheit für alle. ► informieren sie sich jetzt auf unserer homepage ►

vol.at vol.at Vol.at nachrichten aus vorarlberg, österreich und der weltnachrichtenvorarlbergonlineösterreichwelt ▷ alle nachrichten aus vorarlberg und den gemeinden sowie aktuelle news aus österreich und der welt mit vielen themen wie sport, politik, stars, uvm.

mobiflip.de mobiflip.de Mobiflip.de › news & testberichte aus der mobilen welt ▷ news und testberichte aus der mobilen welt. handverlesene infos zu smartphones, tablets, apps, diensten, deals, gadgets und zubehör.

aktiv-gegen-kinderarbeit.de aktiv-gegen-kinderarbeit.de Aktiv gegen kinderarbeit – eine kampagne von earthlink e.v. ▷ eine kampagne von earthlink e.v.

express.de express.de Express.de aktuelle nachrichten aus köln, der welt sowie neues vom sport und der welt der promis. ▷ express - aktuelle nachrichten aus köln, der welt sowie neues vom sport und der welt der promis.

leipzig.de leipzig.de Leipzig.de stadt leipzighomestartleipzig.destadtverwaltungstadt leipzig ▷ das offizielle internet-portal für leipziger bürger, touristen und unternehmen. ein service der stadt leipzig.

smartinfrastructurehub.com smartinfrastructurehub.com Smart infrastructure hub leipzig: an initiativefor innovation (2020) ▷ the smart infrastructure hub is an initiative in leipzig that pushes innovation specifically in the fields of ehealth, energy, and smart city.

pluspol-interactive.de pluspol-interactive.de Digitalagentur aus leipzig pluspol interactive ▷ pluspol interactive | seit 2002 ihre digitalagentur in leipzig für die bereiche webentwicklung, innovation und salesforce

bistahnsdorfsued.org bistahnsdorfsued.org Kana mimura ist eine süße japanerin videokamera heiß chinesische frauen haben sex mit schwarzen männern mir dainbach ausgehen nackte nocken ▷ wenn ihnen und lässt und kana mimura ist eine süße japanerin videokamera heiß chinesische frauen haben sex mit schwarzen männern mir dainbach ausgehen nackte nocken des jungen mädchens macht das ist richtig auf.

sanu.ch sanu.ch sanu bildung und beratung für eine nachhaltige entwicklung ▷ sanu ist anbieterin nachhaltigkeits relevanter weiterbildungen, beratungen und tagungen und renommierte partnerin von unternehmen und öffentlichen körperschaften.

metager.de metager.de Metager mehr als eine suchmaschineinternetsucheprivatsphäreprivacysuchmaschinedatenschutzanonproxyanonym suchenbildersuchesuchmaschineanonymmetagermetagermetager.de ▷ sicher suchen und finden unter wahrung der privatsphäre. das digitale wissen der welt muss ohne bevormundung durch staaten oder konzerne frei zugänglich sein und bleiben.

ksta.de ksta.de Kölner stadt anzeiger aktuelle nachrichten aus köln und der ganzen welt ▷ kölner stadt-anzeiger - aktuelle nachrichten aus köln und der ganzen welt

servicereisen.de servicereisen.de Servicereisen.de service reisen gruppenreisen für europa und die welt (b2b) ▷ ihr spezialist für gruppenreisen in europa und die welt.

delicioustravel.de delicioustravel.de Delicious travel – reiseblog für deutschland, baden württemberg und den rest der welt – reisen. aktiv. genießen. facebook instagram pintereiseblogreisebloggerreiseblog stuttgartreiseblogs baden-württemberg ▷ der leckere reiseblog für aktive genießer von antje seeling aus stuttgart/baden-württemberg – reiseberichte, länderküche-rezepte, genuss-wandern, wein & restaurant-tipps

htwk-leipzig.de htwk-leipzig.de Htwk leipzig ǀ startseite studierenleipzigstudiumhochschuletechnikwissenschaftpraxislehreforschungberufbachelormasterdiplom ▷ studieren sie praxisnah im vielgepriesenen leipzig - an der hochschule für technik, wirtschaft und kultur leipzig (htwk leipzig). wir machen macher!

umadum.info umadum.info Umadum riesenrad münchen das größte mobile riesenrad der welt ▷ ich bin umadum, das münchner riesenrad und durch meine höhe von knapp 80 metern münchens größte attraktion. i gfrei mi auf di!

uni-leipzig.de uni-leipzig.de Universität leipzig: uni leipzig.de ▷ unsere universität wurde 1409 gegründet und gehört zu den forschungsstarken und medizinführenden universitäten deutschlands. sie bietet eine einmalige fächervielfalt von den geistes- und sozialwissenschaften bis zu den natur- u

nwzonline.de nwzonline.de Nachrichten aus oldenburg, region und der welt nwzonlinenachrichten videos bilder sport politik oldenburg ammerland cloppenburg friesland wesermarsch bremen delmenhorst wilhelmshaven aktuelles region automarkt kleinanzeigen immobilien marktplatz ▷ nwzonline ist das internet-portal ihrer nordwest-zeitung. bei uns erfahren sie jetzt alles, worüber die menschen im oldenburger land später sprechen.

abendblatt.de abendblatt.de Nachrichten aus hamburg und der welt hamburger abendblatt hamburgnachrichtennewsnachrichten-archivpolitiksportwirtschaftfinanzenkulturreise ▷ nachrichten aus hamburg und der welt. news aus politik, wirtschaft, sport und kultur. alles, was echte hamburger wissen müssen!

mainpost.de mainpost.de Aktuelle nachrichten aus würzburg, schweinfurt, franken, bayern und der welt main post ▷ nachrichten, anzeigen und termine aus würzburg, schweinfurt, franken, bayern und der welt auf mainpost.de - mit lokal-sport, regionaler wirtschaft und kultur.

masseffect-game.de masseffect-game.de Masseffect game.de ist eine fanseite zu den science fiction rollenspielen von biowaremass effectandromedamerollenspielrpgbiowarexbox oneps4ps3pcxbox 360xboxmicrosoftnewsdownloadsdownloadscreenshotsscreenshotconcept artlinksinformationeninfosscience fictionstoryvideosvideotrailer ▷ topaktuelle & langjährige mass effect-seite zum videospiel von bioware & ea. mit news, fakten, hilfe, infos, bildern, videos, einem forum uvm.

gesundheitshochschule.de gesundheitshochschule.de Srh hochschule für gesundheit gemeinsam für eine gesunde zunkunft ▷ leidenschaft fürs leben ist unsere motivation. werde mit uns zum gesundheitsdenker und gestalte gemeinsam mit uns deinen karriereweg im gesundheitswesen.

tom-coal.de tom-coal.de Pirat im stadtrat leipzig wahlperiode 7 2019 bis 2024 ▷ wahlperiode 7 - 2019 bis 2024

pcwelt.de pcwelt.de das portal für computer und technik pc welt computerwindowstechnikpreisvergleichkaufberatungtestteststest-berichtewindows xpwindows 9pcsoftwarehardware ▷ das portal für computer und technik mit aktuellen news, ratgebern, downloads, tests, video-ratgebern und meldungen aus der computer- und it-branche.

agl-einewelt.de agl-einewelt.de Arbeitsgemeinschaft der eine welt landesnetzwerke e.v. startseite agl dropdown agl icon bulletpoint agl icon forward agl icon instagram agl ic ▷ die agl ist ein entwicklungspolitischer dachverband und zusammenschluss der 16 eine welt-landesnetzwerke in deutschland.

catan.de catan.de Catan.de die offizielle website zu der welt von catan ▷ dies ist die offizielle webseite zu catan, dem berühmten brettspiel von klaus teuber. finde alle informationen zu den brettspiele, den digitalen umsetzungen, turnieren und events.

wissenschaftspodcasts.de wissenschaftspodcasts.de Wisspod: ein »reiseführer« durch die welt der wissen{schaft}spodcastswissenwissenschaftwissenschaftspodcastspodcastspodcastingverzeichnis ▷ wissen{schaft}spodcasts sind podcasts, deren primäres ziel die wissensvermittlung ist. sie zählen zu den beliebtesten podcastangeboten. und das nicht ohne grund: podcasts sind ein sehr persönliches medium und eignen sich zur kommu

equalcareday.de equalcareday.de Equal care day wege in eine fürsorgliche demokratie ▷ der equal care day ruft zu einem internationalen aktionstag auf, um auf mangelnde wertschätzung und unfaire verteilung von carearbeit aufmerksam zu machen.

turn-on.de turn-on.de Turn on aktuelle news, tipps und videos aus der tech welt ▷ turn on bietet dir die aktuellsten techniknews und digital lifestyle-trends – mit täglich neuen videos, tests und tipps.

hre.de hre.de Bauträger und projektentwicklung in leipzig hansa real estate ▷ der starke partner für ihr wohneigentum. als bauträger und projektentwickler bieten wir immobilien in höchster qualität in leipzig, dresden und chemnitz.

1wf.de 1wf.de Eine welt forum aachen e. v. eine welt forum aachen e. v. ▷ das 1wf unterstützt lokale gruppen, die sich auf folgenden ziele verständigt haben: internationale solidarität, menschenrechte, völkerverständigung, eintreten für eine gerechtere welt

oekostattego.de oekostattego.de öko statt ego. gutes einkaufen für eine bessere welt. öko statt ego ▷ öko statt ego“ ist eine initiative deiner bioläden, biosupermärkte und biohersteller. 100% bio. voll öko.

zensus2021.de zensus2021.de Eine neue datenbasis für deutschland zensus 2022zensus 2021statistikvolkszählungeinwohnereinwohnerzahlgebäudewohnungenamtlich ▷ der zensus 2021 liefert verlässliche bevölkerungs- und wohnungszahlen für politik, verwaltung, wirtschaft, wissenschaft und die allgemeinheit. ein projekt der statistischen ämter des bundes und der länder.

weltladen.de weltladen.de Weltladen dachverband interessensvertretung der weltläden ▷ mit vielen infos zum fairen handel und weltläden mit ihren drei säulen produktverkauf, politische arbeit und bildungsarbeit.

oxfam.de oxfam.de Oxfam deutschland für eine gerechte welt. ohne armut.spendespendenhilfsorganisation ▷ unter dem namen oxfam haben sich in deutschland und weltweit menschen zu einer unabhängigen hilfsorganisation zusammengeschlossen.

nsu-ausstellung.de nsu-ausstellung.de Eine reise durch deutschland. die mordserie des nsu.wählen sie aus damenröckenoutdoor- und sportbekleidung für damendamenmode und umstandsmodemodeaccessoires und schmuck im geschäftentdecken sie maxi- und minikleider für damen und vieles mehr. entdecken sie unsere kollektionen - jetzt mehr ▷ nsu ausstellung vom 16. april bis 13. juni 2021 im eisenacher bahnhof oder virtuell auf www.nsu-ausstellung.de

hhl.de hhl.de Hhl leipzig graduate school of management facebook logo (3) twitter group instagram logo fill 3 facebook logo (3) twitter group instagram logo f

heizung-sanitaerbau.de heizung-sanitaerbau.de Heizung sanitärbau leipzig gmbhheizungsbausanitärbauerneuerbare energien ▷ als absolut qualitätsbewusstes unternehmen bieten wir das komplette spektrum der haustechnik für gewerbebau, hotelbau und wohnungsbau.

physio-prophil.de physio-prophil.de Physiotherapie ergotherapie osteopathie leipzig prophil ▷ physiotherapie ergotherapie osteopathie leipzig südvorstadt - prävention und heilung. nachhaltige, effektive therapien, ganzheitliche konzepte. schnelle terminvergabe.

vki-werbung.de vki-werbung.de Werbeanlagen & werbetechnik aus leipzig vki werbung ▷ werbeanlagen von vki-werbung stehen für: ✓ individuelle werbegrafik ✓ traditionsreiches handwerk ✓ digitale werbetechnik ✓ kompetente beratung

blackprintbooster.de blackprintbooster.de Blackprint  für eine nachhaltige & zukunftsfähige gebaute welt ▷ als netzwerk- und knowledge plattform treiben wir digitalisierung, innovation und nachhaltigkeit in der bau- und immobilienwirtschaft voran.

liteproject.de liteproject.de Webdesign, webshops und online marketing in leipzig litecode ▷ wir bietet professionelles online marketing in leipzig. ✓ webdesign ✓ onlineshop ✓ werbeanzeigen ✓ social media ✓ seo ✓ sea ✓ funnel ▷ kostenfrei anfragen!

citti.de citti.de Citti eine unternehmensgruppe stellt sich vor citticittichefs culinarcitti-parkgrossküchentechnikzerssenmarkt der lebensfreudecittimarktflensburglübeckgrossverbraucherlebensmittelmarktcitti24cittparkstralsundrostockneubrandenburgcittiweinonlineshopweinversandbundesweitkielrostockstralsundberlinchampagnersektproseccoweißweinrotweinrothschildtaittingerlansondeutschlanditalienfrankreichspanienchilekaliforniensüdafrikaaustralienneuseelandbordeauxburgundchardonnaychablisgrappacognacsherryjohnsonparkerchateaubodegawinzerschlosscabernetsauvignonpräsentegeschenkeluxuslifestylegourmetfeinschmeckerlebensmittelshoponlinehomeshoppingspezialitätengetränkeeinkaufsupermarkt ▷ citti - das unternehmen stellt sich vor: citti markt - citti-park - chefs culinar unternehmensgruppe - chefs culinar grossküchentechnik - hms

blick.ch blick.ch Blick: nachrichten und schlagzeilen aus der schweiz und aller welt ▷ aktuelle nachrichten, news und kommentare aus wirtschaft, politik, sport, kultur, gesellschaft, wissen & lifestyle. wer informationen sucht, findet blick.ch.

abilium.com abilium.com Abilium gmbh berner technologie für die weltabiliumsoftwareappshardwareodooerpbuchhaltungiottechnologiedigitalisierung ▷ wir entwickeln software und hardware für all ihre bedürfnisse. kontaktieren sie uns unverbindlich und starten sie gemeinsam mit uns in eine digitale und vernetzte zukunft. ergreifen sie die chance.

procivis.ch procivis.ch Procivis – für eine digitale gesellschaft, die begeistert!digitale identitätelektronische identitätdigital wallletmobiler führerscheindigitaler führerscheinsmart governmente-governmentiso 18013-5-normqualifizierte elektronische signaturbgeideidas ▷ mit wegweisenden technologielösungen befähigen wir den öffentlichen sektor, das potenzial der digitalen gesellschaft zu verwirklichen.

brio.de brio.de Gutes spielen macht die welt ein wenig besser brio ▷ spielzeug, das mehr auslöst als nur lachen. klares, einfaches design, das die kreativität und phantasie der kinder anregt. entdecken sie die brio world!

igepa-office.de igepa-office.de Igepa igepa eine weitere wordpress website ▷ eine weitere wordpress-website on igepa…

austriacomplus.at austriacomplus.at Home austria.com plus eine marke von russmedia ▷ austria.com/plus - eine marke von russmedia, ist seit 23 jahren in der onlinevermarktung tätig und der führende premiumvermarkter österreichs. durch die starke regionale relevanz der portale wird eine nationale abdeckung der werbe

sublab.org sublab.org sublab ein hackerspace in leipzig sublabhackerspaceleipzigcomputerlinuxfreie softwarechaos computer clubcccchaostreffchaostreff leipzigarbeitskreis vorratsdatenspeicherungak vorratakvorratfreifunkelektronik rundemultimedialablinux multimedia lab ▷ das sublab ist ein hackerspace im westwerk in leipzig-plagwitz. meet your local hackers here!

webnode.at webnode.at Erstellen sie eine eigene homepage kostenlos!   webnodewebnodewebsite erstellenwebsite erstellen kostenloshomepage erstellenhomepage erstellen kostenloswebseite erstellen gratiswebsite vorlagenwebdesignblog erstellenblog erstellen kostenlosbildergalerie ▷ erstellen sie mit dem editor von webnode ihre eigene website. domain & hosting sind inbegriffen. mit einem schnellen & hilfsbereiten kundenservice✍️?.

jungewelt.de jungewelt.de Junge welt – die linke tageszeitungtageszeitungzeitungjunge weltinlandauslandfeuilletonsport ▷ die junge welt ist eine linke, marxistisch orientierte, überregionale tageszeitung mit einem hohen anteil an hintergrundberichten und umfassenden analysen

argueveur.de argueveur.de Ar gueveur kleine geschichten von meinem ende der welt ▷ geschichten über die bretagne, brettspiele, whisky und andere bemerknisse von meinem ende der welt.

landbote.ch landbote.ch Der landbote nachrichten aus winterthur und der welt ▷ ihre zeitung für winterthur. nachrichten und fakten aus der schweiz und der ganzen welt. auslands-news, wirtschaft, leben, sport & mehr.

spielekenner.de spielekenner.de Spielekenner – rezensionen aus der welt der brett und kartenspiele ▷ spielekenner – rezensionen und spielkritiken von karsten grosser zu brettspielen, kartenspielen und anderen analogen gesellschaftsspielen

sackmuehle.de sackmuehle.de Kaufe nie die mühle im sack (sondern lasse dir eine windkraftanlage schenken.) ▷ kaufe nie die mühle im sack (sondern lasse dir eine windkraftanlage schenken.)

skoutz.de skoutz.de Skoutz vorbeischauen. vergleichen. verlieben. die bunte welt der bücher ▷ vorbeischauen. vergleichen. verlieben. die bunte welt der bücher

bayern-einewelt.de bayern-einewelt.de "bayern eine welt"bayernschulpartnerschaftenkommunalpartnerschaften ▷ auf den seiten des portals bayern - eine welt erfahren sie, welche schulen und kommunen in bayern partnerschaften in so genannten entwicklungsländern unterhalten.

alkofer.net alkofer.net Rund um die weltseoulnamibiashanghaifeldhamstercentral stationkyotoarktisantarktis ▷ arktis dead vlei - namibia feldhamster tschernobyl antarktischer kindergarten moderne zeiten ( seoul ) shanghai central station ( new york) inari tempel ( kyoto )

rundschau-online.de rundschau-online.de Kölnische rundschau nachrichten aus köln, der region und der welt ▷ kölnische rundschau - nachrichten aus köln, der region und der ganzen welt

deafit.org deafit.org Eine it konferenz, die für barrierefreiheit, vielfalt & inklusion steht. deafit ▷ deafit konferenz ist eine barrierefreie veranstaltung für hörbehinderte & hörende it-fachleute mit dem schwerpunkt informationstechnologie.

hft-leipzig.de hft-leipzig.de Hochschule für telekommunikation leipzig: bachelor und master studium hft leipzigbachelorengineeringhftlhochschuleleipzigmasternachrichtentechnikstudium ▷ willkommen auf der homepage der hochschule für telekommunikation leipzig. hier finden sie informationen rund um unsere hochschule.

lancome.de lancome.de Pflege, duft und make up: entdecken sie die welt von lancôme. ▷ das angebot von lancôme entdecken: düfte, make-up, beauty-produkte, hautpflege und gesichtspflege für sie. lancome